ࡱ> }|  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{Root Entry F?~(Workbook_VBA_PROJECT_CUR" linVBAlin  \p Eva Olssn Ba= ThisWorkbook= v 8X@"1Arial1Arial1Arial1Arial1Arial1Arial1 Arial1Arial1Tahoma1Arial1 Arial1Arial1QTahoma1QTahoma1 Arial1$Arial1Arial1Arial""kr"\ #,##0_);\("kr"\ #,##0\)'""kr"\ #,##0_);[Red]\("kr"\ #,##0\)(#"kr"\ #,##0.00_);\("kr"\ #,##0.00\)-("kr"\ #,##0.00_);[Red]\("kr"\ #,##0.00\)@*;_("kr"\ * #,##0_);_("kr"\ * \(#,##0\);_("kr"\ * "-"_);_(@_).))_(* #,##0_);_(* \(#,##0\);_(* "-"_);_(@_)H,C_("kr"\ * #,##0.00_);_("kr"\ * \(#,##0.00\);_("kr"\ * "-"??_);_(@_)6+1_(* #,##0.00_);_(* \(#,##0.00\);_(* "-"??_);_(@_) mmm/yyyy"Ja";"Ja";"Nei""Sann";"Sann";"Usann""P";"P";"Av"                   + ) , *     (     (  *x@ @ <  (8@ @  (  (x@ @  )8@ @ ( ( (x@ @ (8@ @ (8@ @  8@ @  x@ @ 8@ @ (8  *x          x@ @ < x@ @ 8@ @      x@ @ <    |@ @  (X    x@ @   *<@ @  (@ @  ( @  (x@  |@ @  x@ @   x@ @ x@ @  x@ @     (0@ @    x@ @   x@ @ (x@ @ )x@ @  x@ @   p""   x@ @   |@ @  `3EA-listen͘B-listenͲ Endringslogg//!  ;!  ;!  ;g"rj0 3 A@@   Abetalipoproteinemi AcromegaliAdrenogenitalt syndromAlagilles syndromAngelman syndromAngiodysplastisk syndrom"Arthrogryposis multiplex congenitaBechets syndromBeckwith-Wiedemann syndromBlandet bindevevssykdomBronchopulmonal dysplasi Brjeson-Forsman-Lehmann syndrom%Carbohydratdefekt-glycoproteinsyndromCarpenter syndrom Cherubisme ChoanalatresiChondrodysplasiChurg-Strauss syndromCleidocranial DysplasiCoffin-Siris syndrom Cohen syndromCongenitt muskeldystrofiCornelia de Lange syndrom$Craniofacial misdannelse, sammensattCri du Chat syndromCrouzons syndromCurrarinos syndromCushing syndromCystisk fibroseDermatomyosittDiastrofisk chondrodysplasiDiGeorge syndromDubowitz zyndromDuchenne muskeldystrofiDystrofia myotonicaEhlers-Danlos syndromEktodermal dysplasiEllis van Creveld syndromEpifyseal dysplasiErythropoietisk porfyri (EP)%Fibrodysplasia ossificans progressivaFriedreich ataxiFtalt alkoholsyndromGallegangsatresiGenerell dystoniGjellebuesyndrom GlutarsyreuriGoldenhar syndromGorlin syndromGrouchy syndromHemihypertrofiHemofili A og Hemofili BHereditr nevropatiHereditrt angioneurotisk demHoloprosencephaliHolt Oram syndromHunter syndromHuntingtons sykdomHurler syndromHyper IgE mangelHyper IgM syndromHypoalkalisk fosfatemiHypochondroplasi HypofosfatemiHypofosfatemisk rakittHypogammaglobulinemiIncontinentia pigmentiJohanson-Blizzard syndromJoubert syndromJuvenil osteoporoseKabuki syndromKlippel-Feil syndromKlippel-Trnaunay-Weber syndromLangerhans celle histiocytoseLEOPARD syndromLesch-Nyhan syndromLeucocyttadhesjonsdefekt LeukodystrofiLimb Girdle syndrom Lipodystrofi LymfangiomMarfan syndrom Mb. OslerMcCune AlbrightMelnick Needles syndromMicrothia/atresia sekvensMigrasjonsforstyrrelseMiller Dieker syndromMitokondriemyopatiMorquio syndrom MucolipidoseMucopolysaccaridose Mbius sykdomNieman-Pick syndromNoonan syndrom"Oculo-auriculo-vertebralt spectrumOculopharyngeal muskeldystrofiOdho blefarofimose syndrom"Olivopontocerebellar atrofi (I-V) Opitz syndromPappilon-Lefevre syndrom PemphigoidPemphigus (alle varianter)Prader-Willi syndromPrimr oxaloseProteus syndromPseudoachondrodysplasiPseudohypoparathyreoidisme Rett syndromRomberg syndromRubinstein-Taybi syndromSanfilippo syndromScapulo-humoral muskeldystrofiSchimke immuno-osss dysplasiSchinzel-Giedeon syndrom SchizencefaliSilver Russell syndromSjgren-Larsson syndrom SklerodermiSmith-Magenis syndrom!Sotos syndrom/Cerebral gigantismeSpastisk quadriplegiSpinal muskelatrofiSticklers syndromSturge-Webers syndromThomsens myotoniTreacher Collins syndromTricho-dento-ossst-syndrom Tricho-rhino-phalangealt syndromTrigonocephaliTubers skleroseTumoral calcinoseVon Hippel Lindau syndromWeaver syndromWegeners granulomatose West syndromWilliams syndromWolff-Hirschorns syndromAagens syndrom HypofosfatasiOesophagusatresiDIAGNOSEAarskog syndromA-listenB-listenAplastisk anemiDysmeliEpidermolysis bullosa simplexHydrovacciniformeLennox Gastaut syndrom"Lichen planus sykdom, generalisert NevropatiPfeiffer syndrom ENDRINGSLOGGKODEABEACRADRALAALSANGADYAPEAPSBECBWIBBIBROBFLCAMCHGCARCMTCHACHECHOCDYCSTCLECOHCONCOLCMSCRACCHCROCURCUSCFIDERDCHDIGDUBDMDDMYDBLEDAEKTECREBDEPIEPOFOPFSHFreeman Sheldon syndromFATFALGALGDYGBUGSYGOLGORGCYGROHMIHEMHABHENHNEHCPHANHOLHORHTEHTTHURHGEHGMHAFHCHHFFHFRHGGHPAHPIIAGIMMINCJBLJOUJOSKABKFEKTWKROLCHLMBLGALNYLEULDYLGILIPLYMMARMBOMCCMCMMNEMENMETMICMIGMDIMITMORMCAMUCMPSMGRMBINARNETNEUNPINOOOAVOCUOBLOESOLIOPIOSTPLEPEMPVAPWIPOXPROPSEPHYPDURETROMRTASANSHUSIOSGISCHSRUSLASKLSMASOTSQUSMUSEPSTISWESLETHOTRETDOTRPTRITUBTUMVHLWEAWEGWESWILWHIAAGAARAATASKAPLDYSENEEBSHYFKPPLPGNEVPFEVWIHYP/Diagnoseliste for sjeldne medisinske tilstanderLEO Endringslogg KOMMENTAR ENDRET DATONBY#Flere enn 700 i Norge. Ikke sjeldenIgA,IgG mangel NF2Nevrofibromatose 2Lysinurisk protein intoleranseLysinurisk proteinintoleranseFenylketonuri (Fllings sykdom)Withkop and Fried syndromSarkoidose, kronisk%Seropositiv juvenil reumatoid artrittCSI$Flere enn 1000 i Norge. Ikke sjeldenSARSRAWIFNF1ENDRINGInn p B-listenUt av A-listenInn p A-listenMIRBinyrebarksvikt Narkolepsi .Multiple idiopatiske cervikale rotresorpsjoner&Spondyloepifyseal/-metafyseal dysplasiQEktodermale forstyrrelser. Affeksjon av tenner og tannanlegg. Multiple agenesier.Cervikale rotresorpsjonerAMY,Nevrofibromatose 1 med orale manifestasjonerFENLPIFSykdommen krever spesiell kost som ofte bidrar til kt kariesforekomstJAutoimmun lidelse. Revmatoid. Spyttkjertelaffeksjon med sterk munntrrhet.(Alvorlig revmatisk lidelse. Polyartritt.-Omfatter n ogs spondylometaphyseal dysplasiAmyliodose, primr og sekundr%Omfatter n ogs sekundr amyloidose MSkiftet navn fra primr amyloidose og inkluderer n ogs sekundr amyloidose $Inkluderer n ogs spondylometaphyseMBD Mb. DarierNy inn p A-listenIntestinal lymfangiectasiINTSpielmeyer-Vogt syndromSPINy p A-listen# Multiple Endocrine Neoplasia Type1Maple syrup urine disease Systemisk Lupus Erythematosus GUIGuillain-BarreMUL*Multiple endocrine neoplasia type 1(MEN-1)GLY GlykogenoseMAPPOL Polymyositt:Kan forrsake hypomineralisasjon, evt svulster i munnhule.?En sjelden, progresiv tilstand som affiserer hud og slimhinner.LNedsatt muskelfunksjon, tannutviklingsforstyrrelser, utsatt for infeksjoner._Progressiv lidelse, nedsetter motoriske funksjoner. Synonymt med Neuronal ceroid lipofuscinose.)Muskelsvakhet, problemer med munnhygiene. Redusert immunforsvar, hypotoni.FBare alvorligste typer har betydning for kjeveutvikling og oral helse.N. facialis kan affiseres.JKan medfre malokklusjon, evt. tannutviklingsforstyrrelse. Kfr acromegali.PL1Plasminogen mangel type I+Kronisk inflammatorisk sykdom i slimhinner.NAINail-Patella syndromHyposalivasjon, drlig emalje.COW#Cowden syndrom(multiple hamartomer)<Svulster i munnslimhinne. Problemer munnhygiene og estetikk.FAB Fabry sykdomLOELoeys-Dietz syndrom type 2BLoeys-Dietz syndromMEL MELAS syndromMuskelsvakhet, nevropati.'MELAS syndrom(mitokondrie-encefalopati)Infeksjonsrisiko, malokklusjon.1Kjevesmerter, cyster, malokklusjon kan forekomme.Fibrs cemento-osss dysplasiFCDNy p listen fra 01.06.2010 SAPHO syndromSAP SAPHO-syndromRothmund-Thomson syndromRTSBMDBecker muskeldystrofiCEACerebellr ataxiPCDPrimr ciliedyskinesiAlvorlig faktor I-mangelAFIAFVAlvorlig faktor V-mangelAFMAlvorlig faktor VII-mangelATD Endret gruppeSPSStiff person syndromMuskulrt betingede tannskader.Nekrotiserende vaskulitt&Betennelse med srdannelse i blodrer.:Destruksjon av kjeve. Tilbakevirkende kraft fra 01.01.2009IArtritt, unormal benvekst og ostitt. Tilbakevirkende kraft fra 01.01.2009AForstyrrelser tannutvikling. Tilbakevirkende kraft fra 01.01.20095Muskelsvekkelse. Tilbakevirkende kraft fra 01.01.20091Munntrrhet. Tilbakevirkende kraft fra 01.01.2009;Stor bldningstendens. Tilbakevirkende kraft fra 01.01.2009Amyloidose, primrAmyliodose, primr Omfatter bare primr amyloidose.Skiftet navn fra primr og sekundr amyloidose<!Amyotrofisk lateral sklerose(ALS) Apert syndrom6Autoimmunt polyendokrint syndrom(APS) type 1 og type 2AMCCampomelic dysplasi Charcot-Marie-Tooth syndrom(CMT)CHARGE syndromCoffin Lowry syndromCLSCraniosynostose, komplisertOverfrt fra A- til B-listen Skiftet navn fra CraniosynostoseDvblindhet, medfdtGranulocytopeni, primrHennekam syndromHypoparathyreoidisme, medfdtHypopituitarisme, primrImmunsvikt, medfdtFACFacialis parese, medfdt(Kromosomavvik, strukturelle og numeriske(Laurence-Moon-Bardet-Biedl syndrom(LMBB)Maple syrup urine disease(MSUD)$M-CMTC(macrocephaly-cutis marmorata) Menke syndromLIS,Epilepsi, progressiv nekrotiserende tilstandMucocutan candiasis, kroniskMyasthenia gravisNeutropeni, cyklisk NeuroblastomOFD Orofacialt digitalt syndrom(OFD)Osteogenesis imperfecta(OI)PRSPierre Robin sekvensWitkop and Fried syndromUSH Usher syndromNy p listen fra 01.01.2011 DvblindhetLKSLandau- Kleffner syndromLandau-Kleffner syndrom4Tap av ferdigheter, utviklingsforstyrrelse, epilepsiAICAicardi syndromUtviklingshemming, epilepsiBPE/Blepharofimosis-ptose-epicanthus inversus(BPES)0Craniofacial utviklingshemming, liten munnpningAlfa-antitrypsinmangelEpidermalt nevus syndromAndre sjeldne kromosomfeilUt av B-listenKeratoderma-Palmo-PlantarisOverfrt fra B- til A-listenVCFVelocardiofacialt syndrom8Synonymt med DiGeorge syndrom, 22q11.2 delesjons syndromHereditr porfyriMetaphyseal condroplasiNetherton syndrom1Immunforvar m vre affisert nr stnad skal gis.Porfyria variegataInkluderes i akutte porfyrierEr ikke en sjelden tilstandNCLNevronal ceroid lipofuscinose$Synonymt med Spielmeyer-Vogt syndromBORBrankiootorenalt syndrom1Hy gane, ganespalte beskrevet. AnsiktsassymmetriNHSNance Horan syndromLSregne faciale trekk, affiserte tenner. I noen tilfelle mental retardasjon.SCSStre-Chotzen syndrombMalformasjoner.Smal, hy gane, ganespalte. Malokklusjoner, overtallige tenner, emalje hypoplasier.OFGOrofacial granulomatose;Sr munnslimhinne. Munnhygiene kan vre vanskelig utfre.RPKNy p B-listen@Assosiert med alvorlig vaskulitt og autoimmun revmatisk artritt.Kuldeindusert svettesyndromCIS+Spisevansker. Hy gane. Svakhet muskulatur.GASGardner syndrom)Multiple osteomer i kjeve/ansiktsomrdet.ACHAchalasi.sofagus obstruksjon, problemer med svelgning.AKPAkutte porfyrierUOmfatter akutt intermitterende porfyri, porfyrie variegata og hereditr koproporfyri.Lissencephalii LissencefaliMHSMay-Hegglins sykdomBldersykdom, trombocytopenei.ACP Achondroplasi KortvokshetNy p listen fra 01.01.2010Ny p listen fra 01.03.2009 Overfrt fra B-listen 01.01.2011Endret gruppe 01.06.2010'Overfrt fra A- til B-listen 01.01.2011Ny p listen fra 01.01.2008'Overfrt fra A- til B-listen 01.01.2010 Endret betegnelse fra 01.01.2011Endre betegnelse&Synonymt med Velocardiofacialt syndromEndret betegnelse)Synonymt med Nevronal ceroid lipofucinose&Alvorlige trombocytt funksjonsdefekter+Epidermolysis bullosa dystrofisk/junctionalHemifacial microsomi PseudopseudohypoparathyreoidismeResidiverende polykondrittVon Willebrand sykdomMND Underbitt&Maxillo-nasal dysplasi(Binder syndrom)OCR*Oculo-cerebro-renalt syndrom(Lowe syndrom)Mental retardasjonOSC'Osteopathia striata med cranial stenose%Korte rtter, manglende tannfrembruddRIERieger syndrom!Underutviklet premaxilla, agenesiSOL2Solitary median maxillary sentral incisor syndrome#Bare n sentral incisiv i overkjeveEndret betegnelse TAKTakayasus arteritt"Redusert immunforsvar, munntrrhetUtarbeidet av Helsedirektoratet Utarbeidet av Helsedirektoratet Utarbeidet HelsedirektoratetFHH$Familir hypokalsiurisk hyperkalsemi%Anoreksi, hypotoni, mentale endringer5Husk at pasienten m vise dokumentasjon p diagnosen.Sist endret 01.01.2012SPYSpyttkjertelaplasiNy p listen fra 01.01.2012"Tilstanden gir ekstrem munntrrhetFAN Fanconi AnemiMERFAMLHONy p listen fra 01.01.12 NarkolepsiBUL=LHON (Leber Hereditary Optic Neuropathy, Leber Optic Atrophy)PPH Endret kodeEndret fra PEM til PPHLevi-Weill dyschondrosteoseLEWRobinow syndromROBFamilir DysautonomiMedfdt cyklisk neutropeniMedfdt kronisk neutropeniBulls slimhinne- pemfigoidFenylketonuri(Fllings sykdom)*MERRF Myoklon- epilepsi (ragged-red-fiber)MCNMKNBartters SyndromBARSist endret 01.01.2012.ECDNy p listen 01.03.2012Erdheim-Chester disease PachydermoperiostosePACNy p listen fra 01.03.2012LSynonymer: Primr hypertrofisk osteoartropati, Touraine Solente Gole syndrom&Kompleks hereditr spastisk parapareseSPAoOrofacial granulomatose (inkluderer oral manifestasjoner av tilstandene Chron's, ulcers colitt og sarkoidose)Gjelder fra 1.1.2012Lagt til endringene i parentesn #W]l|i#(n= I  u %  U  . ^ ,\2b0`"R PBr@p 2  ;E!!^"q#%%0Q&M'(q)NU*++),V-.(\/;0!11Yo23!4 55k6y7i 8Z Y9 h: u; -< <}=\>;/??Z@#,Acc   <FMT[~c"krzz*҉ގn.  dMbP?_*+%&= ףp=?'?(?)HzG?M\\srv-win-prn-001\uniFLOW UtskF$ ߁ 4dXA4CanonhH` Canon iR 5870C EUR UFR IIddd      d d d d dd    dd@@d  d  d dd d"eddd      !"#$%&'d"    @  !"#$%&'()*+,-d.d/d0123456789:;<=>?@ABCDd     ddd !"#$%&'()*+,-./01234d!ddd d!     d H8  4 22h 1 4 22h 1XXd2 Arial\CNZSRGBA.ICC\CNZSRGBA.ICC\CNZSRGBA.ICC CONFIDENTIALCONFIDENTIALHArialDefault SettingsX  " ZXX??U } $} +} m*} m DIAGNOSEXttFhh     8 T  g l k      2 3  = >           5 6       F   F   F  L F 'u ''               o     F           Dl*&**&&**&****&&&&&&&*&*&&* !"#$%&'()*+,-./0123456789:;<=>?     ! ! ! " "" # # # $ $ $ % % %F & && ' '' ( (( ) )) * ** + ++ , ,, - -- .d .. / // 0 00 1 11 2 2 2@ 3 33 4 44 5 55 6 66 7 77 8 88 9 99 : :: ; ; ; < <!< = ="= > >> ? ?#?DHl&&&&&*&&&&&&&&&&&&*&&&&&&&&&&&&@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_ @ @$@ A A%A B BMB C C&C D D9 D E E'E F F F@ Gt G Go H HH Iq Ir Io J J(J K K K L LL M M)M N N+N O/ O0 O P P-P Q Q.Q R R R@ S S/S T T0T U UU V V1V W WNW X X2X Y Y3Y Z ZZ [ [4[ \ \5\ ] ]6] ^ ^7^ _ _8_D\l&&&&*&**&*&*&&&*&&*&&&&&&&&&&&&`abcdefghijklmnopqrstuvwxyz{|}~ ` `9` a a:a b b;b c c<c d d>d eS ee f f?f g g@g h hAh i ii j jj k k[k l ll m mBm n n9 nA o oCo p pDp q qEq r rFr s sHs t t t u& uu v&- v, v w& w w x xIx y yy z z zB {U {J{ |~ |} |o } }K} ~ ~L~  MDXl&&&&&&&&&&&&&&*&&&&&*&**&&*&*&&  N  O  8    @  P  9 @  Q R T     R  S     o   o   @  T   s 9 o  V  W   X   Y      Z   [   B n q    \   @   !  P  FDpl&&**&*&*&&&&***&&*&&&&&&&*&&&**  66   '\ $]$ ' $   ]  ^  _ U V   `  a    b  c &       X Y   9   d z f Q  B     @  M M   @  g   F   h ! i " j # k $ O % lDhl&&*&&&*&&&&&*&&**&&*&***&*&&&&&888888 [ \  & m   F   o ' n ( o   F ) p * q + r , s g c - t . u / v 0 w ^ _  1 x 2 y 3 z m n o 4 r 5 {   F 6 | # $  8 } 9 ~ :  ;  <  = D`l*&**&&*&&&&&&&&&*&&&*&&*&*&&&&& >       G ?  @  C A  B  C  D  E  F "Dl&**&*&&&&&&      Dl !"#$%&'()*+,-./0123456789:;<=>?Dl@ABCDExdp(  R  C ]F!  mZR  C ]F! m  BM  XPP?\i&]4@M \ @kp"II/] <Kode som fylles ut ved innsending av regning i elektronisk format (KUHR), nr behandlingen gjelder sjeldne medisinske tilstander< ee50420u>@<d7Ark1bb     dMbP?_*+%&= ףp=?'?(?)HzG?M\\SRV-WIN-PRN-001\uniFLOW UtskF$ ߁ 4dXA4CanonhH` Canon iR 5870C EUR UFR IIddd      d d d d dd    dd@@d  d  d dd d"eddd      !"#$%&'d"    @  !"#$%&'()*+,-d.d/d0123456789:;<=>?@ABCDd     ddd !"#$%&'()*+,-./01234d!ddd d!     d H8  4 22h 1 4 22h 1XXd2 Arial\CNZSRGBA.ICC\CNZSRGBA.ICC\CNZSRGBA.ICC CONFIDENTIALCONFIDENTIALHArialDefault SettingsX  " ZXX??U } $} %} } } m DIAGNOSEXtthh      T   e       * &G #  $) &I $ $) &x $ $v) &J % $) &K $  $) &L $ $) (h $i $ ) 'w $ E ) ' $ @) 'N $ $) ' $G $F) 'u 9y $v) 'O $ $)! 'x $_ E )! ': $;  )! ' $w $v )!   D 'i $v $) &) $P $D) &b $c ) &R $Q $):4**4***444*44,888**44 p(  R  C ]F!P mZR  C ]F!    m  Bm  XPP?\i]4@m  KTDH(D0 <Kode som fylles ut ved innsending av regning i elektronisk format (KUHR), nr behandlingen gjelder sjeldne medisinske tilstander<e7e50420u>@<d7Ark2bb   $j2h  dMbP?_*+%&= ףp=?'?(?)HzG?M\\srv-win-prn-001\uniFLOW UtskF$ ߁ 4dXA4CanonhH` Canon iR 5870C EUR UFR IIddd      d d d d dd    dd@@d  d  d dd d"eddd      !"#$%&'d"    @  !"#$%&'()*+,-d.d/d0123456789:;<=>?@ABCDd     ddd !"#$%&'()*+,-./01234d!ddd d!     d H8  4 22h 1 4 22h 1XXd2 Arial\CNZSRGBA.ICC\CNZSRGBA.ICC\CNZSRGBA.ICC CONFIDENTIALCONFIDENTIALHArialDefault SettingsX  " ZXX??U } m3} $,} %,} m,} I)-} ,} m ,DIAGNOSEXtthh.....// / / / / /////////////// +T3++3- +V3E .f4/ .4D4/4/4/ 5X 0 0 0j 0W~ O@ H& H H H~ ; @ H  H I~ ; @ H < H H~ ; @ H 9 H N~ ;@ H  H I~ ;@ Lz f H{ H|~ ;@ Bx C C*H~ ;@ J J KH~ ;@ J J KH~ ;@ B Hp C*H~ ;@ Bu Hy C*H~ ;@ Bt   I~ ;@ Bs 9  I~ ;@ q r ~ ;@   ~ ;@ ~ } ~ ;@ m n  p~ ?@ @h $i :* :j~ ?@ @b :c :* :d~ ?@ @^ _ : :`~ ?@ @[ \ : :]~ ?@ @X Y : :Z~ ?@ @U V : :W~ ?@ :R :T : :SD l""""FFBFBBFBBBBBBBBBBFFFFFFF /!/"/#/$/%/&/'/(/)/*/+/,/-/.///0/1/2/3/4/5/6/7/8/9/:/;/</=/>/?/~ ?@ := :> : :?~ !?@ !:: !:; !:* !:<~ "?@ ":5 ":6 ": ":7~ #?@ #:2 #:3 #: #:4~ $?@ $:/ $:0 $: $:1~ %?@ %:- %:, %: %:.~ &?@ &:) &:P &: &:+~ '?@ ':& ':' ': ':(~ (?@ (:# (:$ (: (:%~ )?@ ):  ):! ): ):"~ *?@ *: *: *: *:~ +?@ +: +: +: +:~ ,?@ ,: ,: ,:J ,:K~ -?@ -:f -:b -:l -:~ .?@ .: .: .:.:~ /?@ /: /: /: /:~ 0?@ 0: 0:U 0:l0:~ 1?@ 1: 1: 1:l1:~ 2?@ 2: 2:= 2:l2:~ 3?@ 3: 3: 3:l3:~ 4?@ 4: 4: 4:a 4~ 5?@ 5: 5: 5:H 5I~ 6?@ 6:Q 6: 6:6:~ 7?@ 7:P 7: 7: 7:~ 8?@ 8: 8: 8:8:~ 9?@ 9: 9: 9:9:~ :?@ ::M :: :: ::~ ;?@ ;:H ;:  ;: ;:~ <?@ <: <: <: <: ~ =?@ =: =: =: =:~ >?@ >: >: >: >:~ ??@ ?: ?: ?: ?:D lFFFFFFFFFFFFFFBFBBBBFFBBBBBBFFF@/A/B/C/D/E/F/G/H/I/J/K/L/M/N/O/P/Q/R/S/T/U/V/W/X/Y/Z/[/\/]/^/_/~ @?@ @:h @: @:l@:~ A?@ A: A:e A:lA:~ B?@ B: B: B:lB:~ C?@ C: C:9 C: C:~ D?@ D: D:, D:lD:~ E?@ E: E:* E:lE:~ F?@ F: F: F:lF:~ G?@ G: G: G:J G:~ H?@ H:u H: H: H:~ I?@@ I:P I: I: I:~ J?@@ J: J: J: J:~ K?@@ K:@ K: K:K:~ L?@@ L: L:L L: L:~ M?@@ M: M: M: M:~ N?@@ N: N: N: N:~ O?@@ O: O: O: O:~ P?@@ P: P: P: P:~ Q?@@ Q: Q: Q: Q:~ R?@@ R: R: R: R:~ S?@@ S: S: S: S:~ T?@@ T: T: T: T:~ U?@@ U: U U: U:~ V?`@ V: V: V: V:~ W?`@ W: W: W: W:~ X?`@ X: X@ X: X:~ Y?`@ Y: Y: Y: Y:~ Z?`@ Z: Z: Z: Z:~ [?`@ [: [: [: [:~ \?`@ \' \$ \:k \:~ ]?`@ ]: ]: ]: ]@~ ^;`@ ^ ^ ^  ^:~ _;`@ _: _< _ _CD$ lBBBFBBBFFFFBFFFFFFFFFFFFFFFFFFF`/a/b/c/d/e/f/g/h/i/j/k/l/m/n/o/pqrstuvwxyz{|}~~ `;`@ `: `<G `k `C~ a;`@ a: a< a aC~ b;`@ b:7 b= blbA~ c; x@ c< c< c(k cC~ d; x@ d d> d dB~ e7a@ e1 e' e' e'~ f7C@ f1u f'} f'~ f'~ g7C@ g(Y g1o g1l g(Z~ h7C@ h(w h(` h(k h(y~ i7C@ i(x i2^ i2k i(y~ j7C@ j1n j1q j1m j1t~ k7C@ k( k1p k1l k(e~ l7C@ l1f l1b l1m l1z~ m7C@ m1g m1c m1m m1{~ n7C@ n14 n'r n1| n1~ o7C@ o1h o1a o1m o1spGqGrGsGtGuGvGwGxGyGzG{G|G}G~GGD|lFFBFFFFFFFFFFFFF GGGGGGGGGGGGGGGGGGGGGGGGGGG:* 0 (   R  C ]F! mZR  C ]F!< d \ZR  C ]F! d m  B,  XPP?3i]4@, < nVWjB` <Kode som fylles ut ved innsending av regning i elektronisk format (KUHR), nr behandlingen gjelder sjeldne medisinske tilstander<e7e50420u>@<d7Ark3bb ThisWorkbookArk1  Ark2  Ark3 0 !"#$%&'()*+,-./123456789:;<=>?ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghjklmnopqsuvwxyz{|~T%y#xME (SLSS<N0{00020819-0000-0000-C000-000000000046}8(%HxAttribute VB_Name = "ThisWorkbook" Bas0{00020P819-0C$0046} |GlobalSpacFalse dCreatablPredeclaIdTru BExposeTemplateDerivBustomizD2T%}B#xME (SLSS<N0{00020820-0000-0000-C000-000000000046}8(%HxAttribute VB_Name = "Ark1" Basl0{00020820- C$0046} |@GlobalSpacFalse CreatablPredeHclaIdTru BExposeTemplateDeriv$ustomizD2T%Χ#xME (SLSS<N0{00020820-0000-0000-C000-000000000046}8(%HxAttribute VB_Name = "Ark2" Basl0{00020820- C$0046} |@GlobalSpacFalse CreatablPredeHclaIdTru BExposeTemplateDeriv$ustomizD2T%B#xME (SLSS<N0{00020820-0000-0000-C000-000000000046}8(%HxAttribute VB_Name = "Ark3" Basl0{00020820- C$0046} |@GlobalSpacFalse CreatablPredeHclaIdTru BExposeTemplateDeriv$ustomizD2_VBA_PROJECT@ diriPROJECTwmrVPROJECT t ay *\G{000204EF-0000-0000-C000-000000000046}#4.0#9#C:\PROGRA~1\COMMON~1\MICROS~1\VBA\VBA6\VBE6.DLL#Visual Basic For Applications*\G{00020813-0000-0000-C000-000000000046}#1.5#0#C:\Program Files\Microsoft Office\OFFICE11\EXCEL.EXE#Microsoft Excel 11.0 Object Library*\G{00020430-0000-0000-C000-000000000046}#2.0#0#C:\WINDOWS\system32\stdole2.tlb#OLE Automation(*\G{2DF8D04C-5BFA-101B-BDE5-00AA0044DE52}#2.3#0#C:\Program Files\Common Files\Microsoft Shared\OFFICE11\MSO.DLL#Microsoft Office 11.0 Object Library  cHT%ThisWorkbook015103c771ThisWorkbooky%Ark1025103c771Ark1}B%Ark2035103c771Ark2Χ0%Ark3045103c771Ark3BH%h0HE"@Ή  =&Bv:IXVX#5sL}5oGtdBFX,K&Excel+VBAWin16~Win32MacVBA6# VBAProjectstdole`Officeu ThisWorkbook| _EvaluateArk1yCArk2zCArk3{CWorkbookk Worksheetl   H0* pHd VBAProject4@j = r cH J< rstdole>stdole h%^*\G{00020430-C 0046}#2.0#0#C:\WINDOWS\syst em32\e2.tlb#OLE Automation`EOffDicEOficEE2DF8D04C-5BFA-101B-BDE5EAAC42Egram Files\CommonMicrosoft Shared\OFFICE11\MSO.0DLL#M 1@1.0 Ob LibraryKET%ThisWorkbookGTisWrkbUo 2 QHB1Bx%B,!y"B+BBArk1G@DAA 12S}B22%22ΧU3333)BBLThisWorkbookThisWorkbookArk1Ark1Ark2Ark2Ark3Ark3ID="{4971A278-F785-4897-A63E-3142A304D90F}" Document=ThisWorkbook/&H00000000 Document=Ark1/&H00000000 Document=Ark2/&H00000000 Document=Ark3/&H00000000 Name="VBAProject" HelpContextID="0" VersionCompatible32="393222000" CMG="1311BE7E7A827A827A827A82" DPB="D3D17EBE3FBF3FBF3F" GC="93913EFEFFFFFFFF00" [Host Extender Info] &H00000001={3832D640-CF90-11CF-8E43-00A0C911005A};VBE;&H00000000 [Workspace] ThisWorkbook=0, 0, 0, 0, C Ark1=0, 0, 0, 0, C Ark2=0, 0, 0, 0, C Ark3=0, 0, 0, 0, C Ark4=0, 0, 0, 0, C Oh+'0 X`p H103766 Eva OlssnMicrSummaryInformation( }DocumentSummaryInformation8MsoDataStore??5YRR0ZZA==2??osoft Excel@x@ڈ@u՜.+,D՜.+,0 PXp x Trygdeetaten'  A-listen B-listen Endringslogg  Regnearkp X This value indicates the number of saves or revisions. The application is responsible for updating this value after each revision. ns:ds="http://schemas.openxmlformats.org/officeDocument/2006/customXml"/>DocumentLibraryFormDocumentLibraryFormDocumentLibraryForm  (4@LXdHdirInterFellesMainLanguageHdirInterFellesTema!j3dc69deab2e4c1b8e49b517619cfe21!n1c639b9675941b68cb46ecf436f4f54HdirInterFellesHovedTema!f79717a20e7b4abba3524317f4e5a63d TaxCatchAll